Fibroblast Growth Factor 7, Active, Recombinant, Human, aa32-194 (FGF7)

Artikelnummer: USB-586892
Artikelname: Fibroblast Growth Factor 7, Active, Recombinant, Human, aa32-194 (FGF7)
Artikelnummer: USB-586892
Hersteller Artikelnummer: 586892
Alternativnummer: USB-586892-10,USB-586892-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. Recombinant protein corresponding to aa32-194 from human Fibroblast growth factor 7, expressed in E.coli. Molecular Weight: ~19.1kD Biological Activity: The ED50 as determined by its ability to bind Human FGFR3 in functional ELISA is less than 5ug/ml. Amino Acid Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.1
UniProt: P21781
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.