Insulin-like Growth Factor-1, Active, Recombinant, Human, aa49-118 (IGF1)(GMP)

Artikelnummer: USB-586926
Artikelname: Insulin-like Growth Factor-1, Active, Recombinant, Human, aa49-118 (IGF1)(GMP)
Artikelnummer: USB-586926
Hersteller Artikelnummer: 586926
Alternativnummer: USB-586926-5,USB-586926-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation Partial recombinant protein corresponding to aa49-118 from human Insulin-like Growth factor-1, expressed in E. coli. Molecular Weight: ~7.6kD Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2ng/ml, corresponding to a specific activity of >5.0*105 IU/mg. Amino Acid Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 7.6
UniProt: P05019
Reinheit: 98% (SDS-PAGE and HPLC) Endotoxin: 1EU/ug
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.0. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.