Interferon lambda-3, Active, Recombinant, Human, His-Tag, aa22-196 (IFNL3)

Artikelnummer: USB-586934
Artikelname: Interferon lambda-3, Active, Recombinant, Human, His-Tag, aa22-196 (IFNL3)
Artikelnummer: USB-586934
Hersteller Artikelnummer: 586934
Alternativnummer: USB-586934-10, USB-586934-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets. Recombinant protein corresponding to aa22-196 from human Interferon lambda 3, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~20.67kD Biological Activity: The ED50 as determined by its ability to binding IL10RB used funtional ELISA is less than 10ug/ml. Amino Acid Sequence: VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.67
UniProt: Q8IZI9
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4, 1mM EDTA. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.