Interleukin-13, Active, Recombinant, Mouse, His-Tag, aa26-131 (Il13)

Artikelnummer: USB-586951
Artikelname: Interleukin-13, Active, Recombinant, Mouse, His-Tag, aa26-131 (Il13)
Artikelnummer: USB-586951
Hersteller Artikelnummer: 586951
Alternativnummer: USB-586951-10, USB-586951-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages. Partial recombinant protein corresponding to aa26-131 from mouse Interleukin 13, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~12.7kD Biological Activity: The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 5ng/ml. Amino Acid Sequence: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 12.7
UniProt: P20109
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.