Ligand for IL17RA and IL17RC Recombinant protein corresponding to aa24-155 from human Interleukin 17A, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~20.5kD Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 500ng/ml. Amino Acid Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
