Interleukin-17A, Active, Recombinant, Mouse, His-Tag, aa22-158 (Il17a)

Artikelnummer: USB-586961
Artikelname: Interleukin-17A, Active, Recombinant, Mouse, His-Tag, aa22-158 (Il17a)
Artikelnummer: USB-586961
Hersteller Artikelnummer: 586961
Alternativnummer: USB-586961-10, USB-586961-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Ligand for IL17RA. Partial recombinant protein corresponding to aa22-158 from mouse Interleukin 17A, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~16.2kD Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 200ng/ml. Amino Acid Sequence: TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.2
UniProt: Q62386
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.