Participates in at least several B-cell activation processes as well as of other cell types. Partial recombinant protein corresponding to aa23-140 from mouse Interleukin 4, expressed in E. coli. Molecular Weight: ~13.4kD Biological Activity: Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED50 for this effect is 0.01ng/ml. Amino Acid Sequence: HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
