Macrophage Colony-stimulating Factor 1, Active, Recombinant, Human, His-Tag, aa33-255 (CSF1)

Artikelnummer: USB-587009
Artikelname: Macrophage Colony-stimulating Factor 1, Active, Recombinant, Human, His-Tag, aa33-255 (CSF1)
Artikelnummer: USB-587009
Hersteller Artikelnummer: 587009
Alternativnummer: USB-587009-10,USB-587009-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Partial recombinant protein corresponding to aa33-255 from human Macrophage colony-stimulating factor 1, fused to 6X His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~26.17kD Biological Activity: The ED50 as determined by its ability to acclerate M-NFS-60-dependent proliferation is less than 10ng/ml. Amino Acid Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.17
UniProt: P09603
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.