Macrophage colony-stimulating factor 1, Active, Recombinant, Mouse, aa33-262 (Csf1)

Artikelnummer: USB-587010
Artikelname: Macrophage colony-stimulating factor 1, Active, Recombinant, Mouse, aa33-262 (Csf1)
Artikelnummer: USB-587010
Hersteller Artikelnummer: 587010
Alternativnummer: USB-587010-10,USB-587010-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. Partial Recombinant protein corresponding to aa33-262 from mouse Macrophage colony-stimulating factor 1, expressed in mammalian cell. Molecular Weight: ~26kD Biological Activity: The ED50 as determined in a cell proliferation assay using M?NFS?60 mouse myelogenous leukemia lymphoblast cells is less than 10ng/ml. Amino Acid Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26
UniProt: P07141
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.