NKG2-D type II integral Membrane Protein, Active, Recombinant, Human, hFc-Tag, aa78-216 (KLRK1)
Artikelnummer:
USB-587018
Hersteller Artikelnummer:
587018
Alternativnummer:
USB-587018-20,USB-587018-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Recombinant protein corresponding to aa78-216 from human NKG2-D type II integral membrane protein, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~43.6kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10ug/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0ng/ml. Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc-Tag and Myc-Tag (CSB-MP887177HU) with an affinity constant of 2.27nM as detected by LSPR Assay. Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human Biotinylated ULBP1(CSB-MP887177HUj1-B), the EC50 is 4.254-7.295ng/ml. Amino Acid Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.