Platelet-derived Growth Factor Subunit A, Active, Recombinant, Human, aa87-211 (PDGFA)
Artikelnummer:
USB-587022
Hersteller Artikelnummer:
587022
Alternativnummer:
USB-587022-10,USB-587022-50
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB (By similarity).. Recombinant protein corresponding to aa87-211 from human Platelet-derived growth factor subunit A, expressed in E.coli. Molecular Weight: ~14.1kD Biological Activity: The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 300ng/ml. Amino Acid Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
