Transforming Growth Factor Beta-1 Proprotein, Active, Recombinant, Human, aa279-390 (TGFB1)

Artikelnummer: USB-587044
Artikelname: Transforming Growth Factor Beta-1 Proprotein, Active, Recombinant, Human, aa279-390 (TGFB1)
Artikelnummer: USB-587044
Hersteller Artikelnummer: 587044
Alternativnummer: USB-587044-10,USB-587044-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) Partial recombinant protein corresponding to aa279-390 from human Transforming growth factor beta-1 protein, expressed in Mammalian cell. Molecular Weight: ~12.8kD Biological Activity: The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 human erthroleukemic cells is less than 0.2ng/ml Amino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 12.8
UniProt: P01137
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from 50mM Glycine-HCl, pH 2.5, 150mM sodium chloride. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.