Receptor for the cytotoxic ligand TNFSF10/TRAIL Partial recombinant protein corresponding to aa56-182 from human Tumor necrosis factor receptor superfamily member 10B, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~15.19kD Biological Activity: The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is less than 100ng/ml. Amino Acid Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
