Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. Partial recombinant protein corresponding to aa1-54 from Tumor necrosis factor receptor superfamily member 17, fused to hFc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.8kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2µg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human protein is 1.912-2.488ng/ml Amino Acid Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
