Bcl2, Recombinant, Human, aa1-211, His-Tag (B Cell lymphoma protein 2 alpha, Apoptosis regulator Bcl-2, Bcl 2, Bcl-2)
Artikelnummer:
USB-B0807-02F
- Bilder (0)
| Artikelname: | Bcl2, Recombinant, Human, aa1-211, His-Tag (B Cell lymphoma protein 2 alpha, Apoptosis regulator Bcl-2, Bcl 2, Bcl-2) |
| Artikelnummer: | USB-B0807-02F |
| Hersteller Artikelnummer: | B0807-02F |
| Alternativnummer: | USB-B0807-02F-100 |
| Hersteller: | US Biological |
| Kategorie: | Molekularbiologie |
| Bcl-2, also known as B-cell lymphoma protein 2 alpha, is an anti-apoptotic protein located primarily in the outer mitochondrial membrane that blocks the apoptotic death of some cells such as lymphocytes. BCL-2 is thought to regulate cell death by controlling the mitochondrial membrane permeability during apotosis. Bcl-2 exerts its anti-apoptotic function through inhibiting caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). The Bcl-2 gene has been related with a number of cancers, including melanoma, breast, prostate, and lung carcinomas, as well as schizophrenia and autoimmunity. Recombinant protein corresponding to aa1-211 from human Bcl2, fused to His-Tag, expressed in E. coli. Molecular Weight: ~25.4kD (MALDI-TOF) Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
Produktgarantie und fachkundiger Support
