Recombinant protein corresponding to Human pro-Brain Natriuretic Peptide (proBNP), N-terminal (aa1-76) expressed in E. coli. Molecular Weight: 8.4kD. Does not contain a fusion partner. Amino Acid Sequence: APLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE VATEGIRGHRKMVLYTLRAPR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
