EGF, Recombinant, Human, Animal Free (Epidermal Growth Factor, Urogastrone, URG)

Artikelnummer: USB-E3410-10
Artikelname: EGF, Recombinant, Human, Animal Free (Epidermal Growth Factor, Urogastrone, URG)
Artikelnummer: USB-E3410-10
Hersteller Artikelnummer: E3410-10
Alternativnummer: USB-E3410-10-100,USB-E3410-10-500
Hersteller: US Biological
Kategorie: Molekularbiologie
Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. Human EGF is a 6.2kD protein containing 53 amino acid residues. Amino Acid Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR Biological Activity: Determined by its ability to stimulate the proliferation of murine BALB/c 3T3 cells. The expected ED50 is 0.1ng/ml corresponding to a specific activity of 1x10e7units/mg. Protein Content: Verified by UV Spectroscopy an/or SDS-PAGE gel. Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 6 months after receipt at -20C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 6.2
Reinheit: 98% (SDS-PAGE and HPLC) Endotoxin: 0.1ng/ug (1EU/ug).
Formulierung: Supplied as a lyophilized powder. No additives. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml. Add 0.1% HSA or BSA for long term storage. Do not vortex.