KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Vo

Artikelnummer: USB-K0136-30A
Artikelname: KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Vo
Artikelnummer: USB-K0136-30A
Hersteller Artikelnummer: K0136-30A
Alternativnummer: USB-K0136-30A-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full-length protein corresponding to aa1-129 of human KCNE1.
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. Applications: Suitable for use in Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 000210
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.