Full-length recombinant protein corresponding to aa1-131 from human LY6E.
Applications: Suitable for use in Western Blot.. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
