PACAP Type I Receptor (Pituitary Adenylate Cyclase-activating Polypeptide Type I Receptor, PACAP-R-1, PACAP-R1, ADCYAP1R1) (APC), Clone: [2B12], Mouse, Monoclonal
PACAP Type I Receptor (Pituitary Adenylate Cyclase-activating Polypeptide Type I Receptor, PACAP-R-1, PACAP-R1, ADCYAP1R1) (APC), Clone: [2B12], Mouse, Monoclonal
PACAP Type I Receptor (Pituitary Adenylate Cyclase-activating Polypeptide Type I Receptor, PACAP-R-1, PACAP-R1, ADCYAP1R1) (APC), Clone: [2B12], Mouse, Monoclonal
Artikelnummer:
USB-P1775-30C-APC
Hersteller Artikelnummer:
P1775-30C-APC
Alternativnummer:
USB-P1775-30C-APC-100
Hersteller:
US Biological
Wirt:
Mouse
Kategorie:
Antikörper
Applikation:
FLISA, WB
Immunogen:
Partial recombinant protein corresponding to aa21-120 from human PACAP Type 1 Receptor with GST tag. MW of the GST tag alone is 26kD.
The PACAP receptor type 1, a member of the vasoactive intestinal polypeptide subfamily, binds the hormone pituitary adenylate cyclase activating polypeptide (PACAP) with high affinity. PACAP is involved in stimulating the secretion of insulin, catecholamines, ACTH, and growth hormone. Additionally, PACAP appears to function as a neuromodulator/neurotransmitter in the central and peripheral nervous systems. Two start codons are reported in literature, one (nt 74-76) results in a 525aa protein with a signal peptide of 77aa encoded by nt 74-304 and the second (nt 245-247) initiates a 468aa protein with a signal peptide of 20aa encoded by nt 245-304. The efficiency of these two start codons is not known. PACAP receptor type 1 expression has been documented in adipose, adrenal, bone, brain, colon, ganglion, heart, lung, ovary, pancreas, placenta, spleen, and uterus. ESTs have been isolated from brain and nerve libraries. Applications: Suitable for use in FLISA and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.