TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3), Goat

Produktübersicht

• Artikelname: TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3), Goat
• Artikelnummer: USB-T8050-45A
• Hersteller Artikelnummer: T8050-45A
• Alternativnummer: USB-T8050-45A-200
• Hersteller: US Biological
• Wirt: Goat
• Kategorie: Antikörper
• Applikation: ELISA, FC, IHC, WB
• Immunogen: Synthetic peptide corresponding to aa151-181, DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, from human TLR5.

Produktbeschreibung

Applications: Suitable for use in ELISA, Western Blot, Flow Cytometry and Immunohistochemistry. Other applications have not been tested. Recommended Dilution: ELISA: 1:37,500 Immunohistochemistry (paraffin): 1:250 Western Blot: 1:50 Flow Cytometry: 1:200 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• UniProt: O60602
• Reinheit: Purified by immunoaffinity chromatography
• Formulierung: Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.