Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomera
Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomera
Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomera
Artikelnummer:
USB-T8064-99D-ML490
Hersteller Artikelnummer:
T8064-99D-ML490
Alternativnummer:
USB-T8064-99D-ML490-100
Hersteller:
US Biological
Wirt:
Mouse
Kategorie:
Antikörper
Applikation:
FLISA, IHC, WB
Immunogen:
Partial recombinant protein corresponding to aa692-765 from human TOP1 with GST tag. MW of GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq] Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Paraffin sections Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.