TSG101 (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (FITC), Clone: [5B7], Mouse, Monoclonal

Artikelnummer: USB-T9101-75C-FITC
Artikelname: TSG101 (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (FITC), Clone: [5B7], Mouse, Monoclonal
Artikelnummer: USB-T9101-75C-FITC
Hersteller Artikelnummer: T9101-75C-FITC
Alternativnummer: USB-T9101-75C-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, IHC, WB
Immunogen: Partial recombinant protein corresponding to aa 201-280 from human TSG101 with GST tag. MW of the GST tag alone is 26kD.
TSG101 belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. Applications: Suitable for use in FLISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Paraffin sections Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [5B7]
NCBI: 006283
Reinheit: Purified.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).