WT1 (Wilms Tumor Protein, WT33) (Azide Free), IgG2b, Clone: [2H4], Mouse, Monoclonal

Artikelnummer: USB-W1125-11K
Artikelname: WT1 (Wilms Tumor Protein, WT33) (Azide Free), IgG2b, Clone: [2H4], Mouse, Monoclonal
Artikelnummer: USB-W1125-11K
Hersteller Artikelnummer: W1125-11K
Alternativnummer: USB-W1125-11K-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Full-length recombinant protein corresponding to aa349-439 of human WT1 with a GST tag. MW of the GST tag alone is 26kD.
This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [2H4]
Isotyp: IgG2b
NCBI: 000369
Reinheit: Purified by immunoaffinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.4. No preservative added (Azide free).