RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2, Cytomegalovirus-induced Gene 5 Protein, CIG5, Viperin, Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) (PE), Clone: [4D10], Mouse,

Produktübersicht

• Artikelname: RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2, Cytomegalovirus-induced Gene 5 Protein, CIG5, Viperin, Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) (PE), Clone: [4D10], Mouse,
• Artikelnummer: USB-132859-PE
• Hersteller Artikelnummer: 132859-PE
• Alternativnummer: USB-132859-PE-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: FLISA, IF, WB
• Immunogen: Partial recombinant protein corresponding to aa262-361 from human RSAD2 with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [4D10]
• NCBI: 080657
• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).