RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2, Cytomegalovirus-induced Gene 5 Protein, CIG5, Viperin, Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) (PE), Clone: [4D10], Mouse,

Catalog Number: USB-132859-PE
Article Name: RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2, Cytomegalovirus-induced Gene 5 Protein, CIG5, Viperin, Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) (PE), Clone: [4D10], Mouse,
Biozol Catalog Number: USB-132859-PE
Supplier Catalog Number: 132859-PE
Alternative Catalog Number: USB-132859-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, WB
Immunogen: Partial recombinant protein corresponding to aa262-361 from human RSAD2 with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4D10]
NCBI: 080657
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).