Anti-ROS1 [ROS1-5F2], Human IgG1, kappa, Monoclonal

Produktübersicht

• Artikelname: Anti-ROS1 [ROS1-5F2], Human IgG1, kappa, Monoclonal
• Artikelnummer: ABA-AB03010-10.0-BT
• Hersteller Artikelnummer: Ab03010-10.0-BT
• Alternativnummer: ABA-AB03010-10.0-BT
• Hersteller: Absolute Antibody
• Wirt: Human
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Alternative Synonym: MCF3, ROS, Proto-oncogene tyrosine-protein kinase ROS, Proto-oncogene c-Ros, Proto-oncogene c-Ros-1, Receptor tyrosine kinase c-ros oncogene 1, c-Ros receptor tyrosine kinase

Produktbeschreibung

The original antibody was generated by immunizing mice intramuscularly with purified peptide GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL and immune enhancer PEI in a ratio of 1:3 and dissolved in a serum free and dual-antibody-free DMEM solution. The purified peptide is identified as a specific binding fragment of PF-06463922 (Crizotinib, Xalkori).

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ROS1-5F2]
• Isotyp: IgG1
• UniProt: P08922
• Puffer: PBS only.
• Target-Kategorie: ROS1