Anti-ROS1 [ROS1-5F2], Human IgG1, kappa, Monoclonal

Product Overview

• Article Name: Anti-ROS1 [ROS1-5F2], Human IgG1, kappa, Monoclonal
• Biozol Catalog Number: ABA-AB03010-10.0-BT
• Supplier Catalog Number: Ab03010-10.0-BT
• Alternative Catalog Number: ABA-AB03010-10.0-BT
• Manufacturer: Absolute Antibody
• Host: Human
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Alternative Names: MCF3, ROS, Proto-oncogene tyrosine-protein kinase ROS, Proto-oncogene c-Ros, Proto-oncogene c-Ros-1, Receptor tyrosine kinase c-ros oncogene 1, c-Ros receptor tyrosine kinase

Product Description

The original antibody was generated by immunizing mice intramuscularly with purified peptide GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL and immune enhancer PEI in a ratio of 1:3 and dissolved in a serum free and dual-antibody-free DMEM solution. The purified peptide is identified as a specific binding fragment of PF-06463922 (Crizotinib, Xalkori).

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ROS1-5F2]
• Isotype: IgG1
• UniProt: P08922
• Buffer: PBS only.
• Target: ROS1