Anti-Phospholipase A2 [AbAb02-PLA2], Mouse IgG1-Fc Fusion,, Monoclonal

Produktübersicht

• Artikelname: Anti-Phospholipase A2 [AbAb02-PLA2], Mouse IgG1-Fc Fusion,, Monoclonal
• Artikelnummer: ABA-AB04531-1.159-BT
• Hersteller Artikelnummer: Ab04531-1.159-BT
• Alternativnummer: ABA-AB04531-1.159-BT
• Hersteller: Absolute Antibody
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA
• Alternative Synonym: PLA2, Snake venom phospholipase A2, Phospholipase A2 5

Produktbeschreibung

A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [AbAb02-PLA2]
• Puffer: PBS only.
• Target-Kategorie: Phospholipase A2