Anti-Phospholipase A2 [AbAb02-PLA2], Mouse IgG1-Fc Fusion,, Monoclonal

Catalog Number: ABA-AB04531-1.159-BT
Article Name: Anti-Phospholipase A2 [AbAb02-PLA2], Mouse IgG1-Fc Fusion,, Monoclonal
Biozol Catalog Number: ABA-AB04531-1.159-BT
Supplier Catalog Number: Ab04531-1.159-BT
Alternative Catalog Number: ABA-AB04531-1.159-BT
Manufacturer: Absolute Antibody
Host: Mouse
Category: Antikörper
Application: ELISA
Alternative Names: PLA2, Snake venom phospholipase A2, Phospholipase A2 5
A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA.
Clonality: Monoclonal
Clone Designation: [AbAb02-PLA2]
Buffer: PBS only.
Target: Phospholipase A2