Tau Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0002
- Bilder (2)
| Artikelname: | Tau Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0002 |
| Hersteller Artikelnummer: | A0002 |
| Alternativnummer: | ABB-A0002-20UL,ABB-A0002-100UL,ABB-A0002-1000UL,ABB-A0002-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TAU, MSTD, PPND, DDPAC, MAPTL, MTBT1, MTBT2, tau-40, FTDP-17, PPP1R103, Tau-PHF6, Tau |
| This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimers disease, Picks disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 79kDa |
| NCBI: | 4137 |
| UniProt: | P10636 |
| Reinheit: | Affinity purification |
| Sequenz: | PSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLA |
| Target-Kategorie: | MAPT |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Stem Cells,Neuron marker |
|
|
|
|
|
Produktgarantie und fachkundiger Support
