Tau Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A0002
- Bilder (0)
| Artikelname: | Tau Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A0002 |
| Hersteller Artikelnummer: | A0002 |
| Alternativnummer: | ABB-A0002-20UL,ABB-A0002-200UL,ABB-A0002-100UL,ABB-A0002-500UL,ABB-A0002-50UL,ABB-A0002-1000UL,ABB-A0002-5UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human Tau (NP_058519.3). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TAU, MSTD, PPND, DDPAC, MAPTL, MTBT1, MTBT2, tau-40, FTDP-17, PPP1R103, Tau-PHF6, Tau |
| This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on sta |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 79kDa |
| NCBI: | 4137 |
| UniProt: | P10636 |
| Quelle: | Rabbit |
| Reinheit: | Affinity purification |
| Sequenz: | DLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL |
| Target-Kategorie: | MAPT |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200 |
| Anwendungsbeschreibung: | Cross-reactivity: Human,Mouse,Rat, Research area: Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrill |
Produktgarantie und fachkundiger Support
