Tau Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Tau Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0002
• Supplier Catalog Number: A0002
• Alternative Catalog Number: ABB-A0002-20UL,ABB-A0002-200UL,ABB-A0002-100UL,ABB-A0002-500UL,ABB-A0002-50UL,ABB-A0002-1000UL,ABB-A0002-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human Tau (NP_058519.3).
• Conjugation: Unconjugated
• Alternative Names: TAU, MSTD, PPND, DDPAC, MAPTL, MTBT1, MTBT2, tau-40, FTDP-17, PPP1R103, Tau-PHF6, Tau

Product Description

This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on sta

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 79kDa
• NCBI: 4137
• UniProt: P10636
• Source: Rabbit
• Purity: Affinity purification
• Sequence: DLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
• Target: MAPT
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrill