[KO Validated] RB Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] RB Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0003
• Hersteller Artikelnummer: A0003
• Alternativnummer: ABB-A0003-50UL,ABB-A0003-200UL,ABB-A0003-100UL,ABB-A0003-500UL,ABB-A0003-1000UL,ABB-A0003-20UL,ABB-A0003-5UL
• Hersteller: ABclonal
• Kategorie: Antikörper
• Applikation: IF, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2).
• Konjugation: Unconjugated
• Alternative Synonym: RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1

Produkteigenschaften

• Molekulargewicht: 106kDa
• NCBI: 5925
• UniProt: P06400
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: RSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
• Target-Kategorie: RB1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human, Research area: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair,Protein phosphorylation,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G1 S Che