[KO Validated] RB Rabbit pAb, Unconjugated

Product Overview

• Article Name: [KO Validated] RB Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0003
• Supplier Catalog Number: A0003
• Alternative Catalog Number: ABB-A0003-50UL,ABB-A0003-200UL,ABB-A0003-100UL,ABB-A0003-500UL,ABB-A0003-1000UL,ABB-A0003-20UL,ABB-A0003-5UL
• Manufacturer: ABclonal
• Category: Antikörper
• Application: IF, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2).
• Conjugation: Unconjugated
• Alternative Names: RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1

Product Properties

• Molecular Weight: 106kDa
• NCBI: 5925
• UniProt: P06400
• Source: Rabbit
• Purity: Affinity purification
• Sequence: RSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
• Target: RB1

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human, Research area: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair,Protein phosphorylation,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G1 S Che