Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0005
• Hersteller Artikelnummer: A0005
• Alternativnummer: ABB-A0005-200UL,ABB-A0005-1000UL,ABB-A0005-100UL,ABB-A0005-50UL,ABB-A0005-500UL,ABB-A0005-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1130-1230 of human Insulin Receptor (NP_000199.2).
• Konjugation: Unconjugated
• Alternative Synonym: HHF5, CD220, Insulin Receptor

Produktbeschreibung

This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this r

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 156kDa
• NCBI: 3643
• UniProt: P06213
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: PPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEIT
• Target-Kategorie: INSR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Mouse,Rat, Research area: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Endocr