Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A0005
Article Name: Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A0005
Supplier Catalog Number: A0005
Alternative Catalog Number: ABB-A0005-200UL,ABB-A0005-1000UL,ABB-A0005-100UL,ABB-A0005-50UL,ABB-A0005-500UL,ABB-A0005-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1130-1230 of human Insulin Receptor (NP_000199.2).
Conjugation: Unconjugated
Alternative Names: HHF5, CD220, Insulin Receptor
This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this r
Clonality: Polyclonal
Molecular Weight: 156kDa
NCBI: 3643
UniProt: P06213
Source: Rabbit
Purity: Affinity purification
Sequence: PPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEIT
Target: INSR
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200
Application Notes: Cross-reactivity: Mouse,Rat, Research area: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Endocr