TLR4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A0007
- Bilder (0)
| Artikelname: | TLR4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A0007 |
| Hersteller Artikelnummer: | A0007 |
| Alternativnummer: | ABB-A0007-100UL,ABB-A0007-200UL,ABB-A0007-20UL,ABB-A0007-1000UL,ABB-A0007-500UL,ABB-A0007-50UL,ABB-A0007-5UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 27-228 of human TLR4 (NP_612564.1). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TOLL, CD284, TLR-4, ARMD10, TLR4 |
| The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 96kDa |
| NCBI: | 7099 |
| UniProt: | O00206 |
| Quelle: | Rabbit |
| Reinheit: | Affinity purification |
| Sequenz: | EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRL |
| Target-Kategorie: | TLR4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200 |
| Anwendungsbeschreibung: | Cross-reactivity: Human,Mouse, Research area: Immunology Inflammation,CDs,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular |
Produktgarantie und fachkundiger Support
