TLR4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TLR4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0007
• Supplier Catalog Number: A0007
• Alternative Catalog Number: ABB-A0007-100UL,ABB-A0007-200UL,ABB-A0007-20UL,ABB-A0007-1000UL,ABB-A0007-500UL,ABB-A0007-50UL,ABB-A0007-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-228 of human TLR4 (NP_612564.1).
• Conjugation: Unconjugated
• Alternative Names: TOLL, CD284, TLR-4, ARMD10, TLR4

Product Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 96kDa
• NCBI: 7099
• UniProt: O00206
• Source: Rabbit
• Purity: Affinity purification
• Sequence: EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRL
• Target: TLR4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse, Research area: Immunology Inflammation,CDs,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular