PTEN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A0008
- Bilder (0)
| Artikelname: | PTEN Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A0008 |
| Hersteller Artikelnummer: | A0008 |
| Alternativnummer: | ABB-A0008-1000UL,ABB-A0008-50UL,ABB-A0008-200UL,ABB-A0008-500UL,ABB-A0008-100UL,ABB-A0008-20UL,ABB-A0008-5UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human PTEN (NP_000305.3). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del, PTENbeta, PTEN |
| This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a cat |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 47kDa |
| NCBI: | 5728 |
| UniProt: | P60484 |
| Quelle: | Rabbit |
| Reinheit: | Affinity purification |
| Sequenz: | MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHL |
| Target-Kategorie: | PTEN |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200 |
| Anwendungsbeschreibung: | Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,Kinase,PI3K-Akt Signaling Pathway,mTOR Signaling |
Produktgarantie und fachkundiger Support
