PTEN Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PTEN Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0008
• Supplier Catalog Number: A0008
• Alternative Catalog Number: ABB-A0008-1000UL,ABB-A0008-50UL,ABB-A0008-200UL,ABB-A0008-500UL,ABB-A0008-100UL,ABB-A0008-20UL,ABB-A0008-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human PTEN (NP_000305.3).
• Conjugation: Unconjugated
• Alternative Names: BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del, PTENbeta, PTEN

Product Description

This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a cat

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 5728
• UniProt: P60484
• Source: Rabbit
• Purity: Affinity purification
• Sequence: MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHL
• Target: PTEN
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,Kinase,PI3K-Akt Signaling Pathway,mTOR Signaling