Cytokeratin 4 (KRT4) Rabbit mAb, Clone: [ARC1804], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: Cytokeratin 4 (KRT4) Rabbit mAb, Clone: [ARC1804], Unconjugated, Monoclonal
• Artikelnummer: ABB-A0013
• Hersteller Artikelnummer: A0013
• Alternativnummer: ABB-A0013-100UL,ABB-A0013-200UL,ABB-A0013-1000UL,ABB-A0013-50UL,ABB-A0013-500UL,ABB-A0013-20UL,ABB-A0013-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (KRT4) (P19013).
• Konjugation: Unconjugated
• Alternative Synonym: K4, CK4, CK-4, CYK4, WSN1, Cytokeratin 4 (KRT4)

Produktbeschreibung

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified e

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1804]
• Molekulargewicht: 56kDa
• NCBI: 3851
• UniProt: P19013
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
• Target-Kategorie: KRT4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Microtubules,Extracellular Matrix,Keratin