Cytokeratin 4 (KRT4) Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Cytokeratin 4 (KRT4) Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0013
• Hersteller Artikelnummer: A0013
• Alternativnummer: ABB-A0013-20UL,ABB-A0013-100UL,ABB-A0013-1000UL,ABB-A0013-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: K4, CK4, CK-4, CYK4, WSN1, Cytokeratin 4 (KRT4)

Produktbeschreibung

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1804]
• Molekulargewicht: 56kDa
• NCBI: 3851
• UniProt: P19013
• Reinheit: Affinity purification
• Sequenz: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
• Target-Kategorie: KRT4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:4000|IF-P,1:100 - 1:400|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Microtubules,Extracellular Matrix,Keratin

Bilder