Cytokeratin 4 (KRT4) Rabbit mAb, Unconjugated

Product Overview

• Article Name: Cytokeratin 4 (KRT4) Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0013
• Supplier Catalog Number: A0013
• Alternative Catalog Number: ABB-A0013-20UL,ABB-A0013-100UL,ABB-A0013-1000UL,ABB-A0013-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: K4, CK4, CK-4, CYK4, WSN1, Cytokeratin 4 (KRT4)

Product Description

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC1804]
• Molecular Weight: 56kDa
• NCBI: 3851
• UniProt: P19013
• Purity: Affinity purification
• Sequence: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
• Target: KRT4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:4000|IF-P,1:100 - 1:400|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Microtubules,Extracellular Matrix,Keratin

Images