Cytokeratin 4 (KRT4) Rabbit mAb, Clone: [ARC1804], Unconjugated, Monoclonal

Product Overview

• Article Name: Cytokeratin 4 (KRT4) Rabbit mAb, Clone: [ARC1804], Unconjugated, Monoclonal
• Biozol Catalog Number: ABB-A0013
• Supplier Catalog Number: A0013
• Alternative Catalog Number: ABB-A0013-100UL,ABB-A0013-200UL,ABB-A0013-1000UL,ABB-A0013-50UL,ABB-A0013-500UL,ABB-A0013-20UL,ABB-A0013-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (KRT4) (P19013).
• Conjugation: Unconjugated
• Alternative Names: K4, CK4, CK-4, CYK4, WSN1, Cytokeratin 4 (KRT4)

Product Description

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified e

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC1804]
• Molecular Weight: 56kDa
• NCBI: 3851
• UniProt: P19013
• Source: Rabbit
• Purity: Affinity purification
• Sequence: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
• Target: KRT4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Microtubules,Extracellular Matrix,Keratin