Ret Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Ret Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0018
• Hersteller Artikelnummer: A0018
• Alternativnummer: ABB-A0018-1000UL,ABB-A0018-50UL,ABB-A0018-500UL,ABB-A0018-20UL,ABB-A0018-100UL,ABB-A0018-200UL,ABB-A0018-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ret (NP_066124.1).
• Konjugation: Unconjugated
• Alternative Synonym: PTC, MTC1, HSCR1, MEN2A, MEN2B, CDHF12, CDHR16, RET-ELE1, Ret

Produktbeschreibung

This gene encodes a transmembrane receptor and member of the tyrosine protein kinase family of proteins. Binding of ligands such as GDNF (glial cell-line derived neurotrophic factor) and other related proteins to the encoded receptor stimulates receptor

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 124kDa
• NCBI: 5979
• UniProt: P07949
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: DISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWM
• Target-Kategorie: RET
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors