Ret Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A0018
Article Name: Ret Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A0018
Supplier Catalog Number: A0018
Alternative Catalog Number: ABB-A0018-1000UL,ABB-A0018-50UL,ABB-A0018-500UL,ABB-A0018-20UL,ABB-A0018-100UL,ABB-A0018-200UL,ABB-A0018-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ret (NP_066124.1).
Conjugation: Unconjugated
Alternative Names: PTC, MTC1, HSCR1, MEN2A, MEN2B, CDHF12, CDHR16, RET-ELE1, Ret
This gene encodes a transmembrane receptor and member of the tyrosine protein kinase family of proteins. Binding of ligands such as GDNF (glial cell-line derived neurotrophic factor) and other related proteins to the encoded receptor stimulates receptor
Clonality: Polyclonal
Molecular Weight: 124kDa
NCBI: 5979
UniProt: P07949
Source: Rabbit
Purity: Affinity purification
Sequence: DISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWM
Target: RET
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors