KAT9/Elp3 Rabbit mAb, Unconjugated
Artikelnummer:
ABB-A0020
- Bilder (3)
| Artikelname: | KAT9/Elp3 Rabbit mAb, Unconjugated |
| Artikelnummer: | ABB-A0020 |
| Hersteller Artikelnummer: | A0020 |
| Alternativnummer: | ABB-A0020-100UL,ABB-A0020-20UL,ABB-A0020-1000UL,ABB-A0020-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KAT9, KAT9/Elp3 |
| Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC1806] |
| Molekulargewicht: | 62kDa |
| NCBI: | 55140 |
| UniProt: | Q9H9T3 |
| Reinheit: | Affinity purification |
| Sequenz: | MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVA |
| Target-Kategorie: | ELP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:6000|IHC-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. |



