KAT9/Elp3 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: KAT9/Elp3 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0020
• Hersteller Artikelnummer: A0020
• Alternativnummer: ABB-A0020-100UL,ABB-A0020-20UL,ABB-A0020-1000UL,ABB-A0020-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: KAT9, KAT9/Elp3

Produktbeschreibung

Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1806]
• Molekulargewicht: 62kDa
• NCBI: 55140
• UniProt: Q9H9T3
• Reinheit: Affinity purification
• Sequenz: MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVA
• Target-Kategorie: ELP3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones.

Bilder

Immunohistochemistry analysis of paraffin-embedded Rat brain using KAT9/Elp3 Rabbit mAb (A0020) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using KAT9/Elp3 Rabbit mAb (A0020) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using KAT9/Elp3 Rabbit mAb (A0020) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.