KAT9/Elp3 Rabbit mAb, Clone: [ARC1806], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: KAT9/Elp3 Rabbit mAb, Clone: [ARC1806], Unconjugated, Monoclonal
• Artikelnummer: ABB-A0020
• Hersteller Artikelnummer: A0020
• Alternativnummer: ABB-A0020-100UL,ABB-A0020-200UL,ABB-A0020-20UL,ABB-A0020-1000UL,ABB-A0020-50UL,ABB-A0020-500UL,ABB-A0020-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-547 of human KAT9/Elp3 (Q9H9T3).
• Konjugation: Unconjugated
• Alternative Synonym: KAT9, KAT9/Elp3

Produktbeschreibung

Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1806]
• Molekulargewicht: 62kDa
• NCBI: 55140
• UniProt: Q9H9T3
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDV
• Target-Kategorie: ELP3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones