KAT9/Elp3 Rabbit mAb, Unconjugated

Product Overview

• Article Name: KAT9/Elp3 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0020
• Supplier Catalog Number: A0020
• Alternative Catalog Number: ABB-A0020-100UL,ABB-A0020-20UL,ABB-A0020-1000UL,ABB-A0020-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KAT9, KAT9/Elp3

Product Description

Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC1806]
• Molecular Weight: 62kDa
• NCBI: 55140
• UniProt: Q9H9T3
• Purity: Affinity purification
• Sequence: MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVA
• Target: ELP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones.

Images

Immunohistochemistry analysis of paraffin-embedded Rat brain using KAT9/Elp3 Rabbit mAb (A0020) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using KAT9/Elp3 Rabbit mAb (A0020) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using KAT9/Elp3 Rabbit mAb (A0020) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.