KAT9/Elp3 Rabbit mAb, Clone: [ARC1806], Unconjugated, Monoclonal

Catalog Number: ABB-A0020
Article Name: KAT9/Elp3 Rabbit mAb, Clone: [ARC1806], Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A0020
Supplier Catalog Number: A0020
Alternative Catalog Number: ABB-A0020-100UL,ABB-A0020-200UL,ABB-A0020-20UL,ABB-A0020-1000UL,ABB-A0020-50UL,ABB-A0020-500UL,ABB-A0020-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-547 of human KAT9/Elp3 (Q9H9T3).
Conjugation: Unconjugated
Alternative Names: KAT9, KAT9/Elp3
Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex.
Clonality: Monoclonal
Clone Designation: [ARC1806]
Molecular Weight: 62kDa
NCBI: 55140
UniProt: Q9H9T3
Source: Rabbit
Purity: Affinity purification
Sequence: MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDV
Target: ELP3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones