KAT9/Elp3 Rabbit mAb, Unconjugated

Product Overview

• Article Name: KAT9/Elp3 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0020
• Supplier Catalog Number: A0020
• Alternative Catalog Number: ABB-A0020-100UL,ABB-A0020-20UL,ABB-A0020-1000UL,ABB-A0020-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KAT9, KAT9/Elp3

Product Description

Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC1806]
• Molecular Weight: 62kDa
• NCBI: 55140
• UniProt: Q9H9T3
• Purity: Affinity purification
• Sequence: MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVA
• Target: ELP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones

Images