Tyrosine Hydroxylase Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Tyrosine Hydroxylase Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0028
• Hersteller Artikelnummer: A0028
• Alternativnummer: ABB-A0028-100UL,ABB-A0028-20UL,ABB-A0028-500UL,ABB-A0028-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TYH, DYT14, DYT5b, Tyrosine Hydroxylase

Produktbeschreibung

The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 59kDa
• NCBI: 7054
• UniProt: P07101
• Reinheit: Affinity purification
• Sequenz: KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
• Target-Kategorie: TH
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Endocrine Metabolism,Amino acid metabolism,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Neuron marker.

Bilder

Immunofluorescence analysis of Neuro-2a cells using Tyrosine Hydroxylase Rabbit pAb (A0028) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of SH-SY5Y cells using Tyrosine Hydroxylase Rabbit pAb (A0028) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western blot analysis of lysates from Jurkat cells usingTyrosine Hydroxylase Rabbit pAb (A0028) at1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.