Tyrosine Hydroxylase Rabbit pAb, Unconjugated

Catalog Number: ABB-A0028
Article Name: Tyrosine Hydroxylase Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0028
Supplier Catalog Number: A0028
Alternative Catalog Number: ABB-A0028-100UL,ABB-A0028-20UL,ABB-A0028-500UL,ABB-A0028-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TYH, DYT14, DYT5b, Tyrosine Hydroxylase
The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 7054
UniProt: P07101
Purity: Affinity purification
Sequence: KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Target: TH
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Endocrine Metabolism,Amino acid metabolism,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Neuron marker