STIP1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0036
Artikelname: STIP1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0036
Hersteller Artikelnummer: A0036
Alternativnummer: ABB-A0036-20UL,ABB-A0036-100UL,ABB-A0036-500UL,ABB-A0036-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521, STIP1
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A, MIM 140550) and HSP90 (see HSP90AA1, MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1805]
Molekulargewicht: 63kDa
NCBI: 10963
UniProt: P31948
Reinheit: Affinity purification
Sequenz: EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEG
Target-Kategorie: STIP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Neuroscience,Neurodegenerative Diseases.