STIP1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0036
Article Name: STIP1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0036
Supplier Catalog Number: A0036
Alternative Catalog Number: ABB-A0036-20UL,ABB-A0036-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521, STIP1
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A, MIM 140550) and HSP90 (see HSP90AA1, MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).
Clonality: Monoclonal
Clone Designation: [ARC1805]
Molecular Weight: 63kDa
NCBI: 10963
UniProt: P31948
Purity: Affinity purification
Sequence: EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEG
Target: STIP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Neuroscience,Neurodegenerative Diseases